PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1736210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Dof
Protein Properties Length: 290aa    MW: 30957.6 Da    PI: 6.9499
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1736210.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-383494262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+ k+s
  Lj4g3v1736210.1 34 NNQALKCPRCDSINTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSTKRS 94
                     6799****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-263388IPR003851Zinc finger, Dof-type
PfamPF027018.4E-333692IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3763892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MQEIHPIGGG GGGGGGSRFF GGADRRLRPH HQQNNQALKC PRCDSINTKF CYYNNYNLSQ  60
PRHFCKNCRR YWTKGGVLRN VPVGGGCRKS TKRSSKPKNS SSSETTDLQL PEPEHNSNSH  120
SSSESSSLTA AVTEAVSAPA LNSDPNSNNM HESKLLNSVL DANALEQAGT GDCGGGGIFS  180
EIGNFTSLIA SSSTTNDALA FGFGNNNGIP PDASSFQWQH HHPGEQELKL QGNILSAAAG  240
GNGGGFGSLD WHSGGADHQG LFDLPNTVDQ AYWNHTHWSD HDNSTLFHLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0097690.0AP009769.1 Lotus japonicus genomic DNA, clone: LjT13A22, TM1930, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506030.11e-103PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLV7CE951e-101V7CE95_PHAVU; Uncharacterized protein
STRINGGLYMA05G07460.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-36OBF binding protein 4